Jump to content

Forssell swaps blue for green and brown


Maksimov

Recommended Posts



What kind of twisted mind invents a language like this?

Suomen jalkapallomaajoukkueen kärkipelaaja Mikael Forssell aloitti varusmiespalveluksensa torstaina Lahden Urheilukoulussa. Ensimmäiseen päivään kuului totuttuun tapaan varusteiden hakeminen varusvarastolta.

How can jalkapallomaajoukkueen and varusmiespalveluksensa be words? The ink industry must make a killing!!

Link to comment
Share on other sites

What kind of twisted mind invents a language like this?

I'd like to ask the Welsh the same question. icon_lol.gif

At least we know how to use vowels... icon_lol.gif

How can jalkapallomaajoukkueen and varusmiespalveluksensa be words?

Easy...you just ram loads of words together to make bigger words.

jalkapallomaajoukkueen = football national team's

varusmiespalveluksensa = his military service

icon_lol.gif

Link to comment
Share on other sites

What kind of twisted mind invents a language like this?

I'd like to ask the Welsh the same question. icon_lol.gif

At least we know how to use vowels... icon_lol.gif

How can jalkapallomaajoukkueen and varusmiespalveluksensa be words?

Easy...you just ram loads of words together to make bigger words.

Which is what the Welsh do:

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch, which translates as:

"The church of St. Mary in the hollow of white hazel trees near the rapid whirlpool by St. Tysilio's of the red cave".

Not to be confused with The church of St. Mary in the hollow of white hazel trees near the rapid whirlpool by St. Tysilio's of the green cave, obviously icon_wink.gif

No idea what this one means though:

Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronukupokaiwhenu

aakitanarahu

It's in New Zealand apparently. And from Thailand we have:

Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop

nopparatrajathaniburiromudomrajaniwesmahasatharn

amornphimarnavatarnsathitsakkattiyavisanukamprasit

Link to comment
Share on other sites



Aargh I see how it works - so it would be like us saying

crazyscandinavianswhohavelostsightoftheimportanceofbreathingwhilstspeaking

By the way a defence constituting purely of 'we are not as bad as the Welsh' is not advisable! Nick Leeson tried it and he was referring to Micky Thomas!

Link to comment
Share on other sites

Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop

nopparatrajathaniburiromudomrajaniwesmahasatharn

amornphimarnavatarnsathitsakkattiyavisanukamprasit

That means 'two sugars please'

Link to comment
Share on other sites

They've got a football team, you know. Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop

nopparatrajathaniburiromudomrajaniwesmahasatharn

amornphimarnavatarnsathitsakkattiyavisanukamprasit Wanderers.

They've only got one chant. Shortly after kickoff, this huge fat bloke starts them off with "I'll give you a k-ay-ay... " And on a good day they manage to get to "and what have you got" just before the final whistle, but by that time over 95% of the crowd are too knackered to deliver the punchline.

Link to comment
Share on other sites



See...our words are not that long and complicated. The best we can manage is atomiydinenergiareaktorigeneraattorilauhduttajaturbiiniratasvaihde. 317.gif

The Swedish on the other hand have this:

nordöstersjökustartilleriflygspaningssimulatoranläggningsmateriel-underhållsuppfölningssystemdiskussionsinläggsförberedelse-arbeten

Even we split that into separate words when we translate it. icon_lol.gif

Link to comment
Share on other sites

Ignoring all the very poor jokes on this thread about a language we do not speak can anyone please actually tell me just why Mika is dressed like that!!!?!???

Link to comment
Share on other sites



Ignoring all the very poor jokes on this thread about a language we do not speak can anyone please actually tell me just why Mika is dressed like that!!!?!???

He's started his military service.

Link to comment
Share on other sites





Ignoring all the very poor jokes on this thread about a language we do not speak can anyone please actually tell me just why Mika is dressed like that!!!?!???

He's started his military service.

f**k Me.

With his injury record playing football, is that a bad move or what?

Link to comment
Share on other sites

Bad move or not, he doesn't have much choice. 317.gif

Well, there's prison and the non-military service, but serving the shortest possible military service, he will get it done with the least amount of distraction to his football career abroad.

Link to comment
Share on other sites



How long will his military service last?

Six months, but he'll be serving in the Sports School at Häme Regiment where practically all Finnish top athletes serve, so the service schedules are tailored in a way that the athletes' training suffers as little as possible. They get to train as regularily as possible, although I'm not sure where Forssell would train. Maybe he will train with FC Lahti, which is a local football club in the city where the Häme Regiment is situated in.

Link to comment
Share on other sites

With his injury record playing football, is that a bad move or what?

can see it now "right lads, were gonna charge the enemy" "hang on sarge, i cant. my hamstrings gone again"

Link to comment
Share on other sites

Guest
This topic is now closed to further replies.
  • Recently Browsing   0 members

    • No registered users viewing this page.
×
×
  • Create New...
Please Sign In or Sign Up

Well, this is awkward!

Happy Sunny Days GIF by Atlassian

The Shed End Forum relies on revenue to pay for hosting and upgrades. While we try to keep adverts as unobtrusive as possible, we need to show these to make sure we can stay online and continue to keep the forum running. Over the years costs have become very high.

Could you please allow adverts on this domain by switching it off and whitelisting the website? Some of the advert banners can actually be closed to avoid interference with your experience on The Shed End.

If you don't want to view any adverts while logged in and using your account, consider using the Ad-Free Subscription which is renewable every year. To buy a subscription, log in to your account and click the link under the Newbies forum on the home page.

Cheers now!

Sure, let me in!